SULT1A1 purified MaxPab mouse polyclonal antibody (B01P) View larger

SULT1A1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULT1A1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SULT1A1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006817-B01P
Product name: SULT1A1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SULT1A1 protein.
Gene id: 6817
Gene name: SULT1A1
Gene alias: HAST1/HAST2|MGC131921|MGC5163|P-PST|PST|ST1A3|STP|STP1|TSPST1
Gene description: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
Genbank accession: BC000923.2
Immunogen: SULT1A1 (AAH00923.1, 1 a.a. ~ 295 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Protein accession: AAH00923.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006817-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SULT1A1 expression in transfected 293T cell line (H00006817-T01) by SULT1A1 MaxPab polyclonal antibody.

Lane 1: SULT1A1 transfected lysate(32.45 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SULT1A1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart