Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STXBP1 monoclonal antibody (M01), clone 6D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about STXBP1 monoclonal antibody (M01), clone 6D1
| Brand: | Abnova |
| Reference: | H00006812-M01 |
| Product name: | STXBP1 monoclonal antibody (M01), clone 6D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STXBP1. |
| Clone: | 6D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6812 |
| Gene name: | STXBP1 |
| Gene alias: | EIEE4|MUNC18-1|UNC18|hUNC18|rbSec1 |
| Gene description: | syntaxin binding protein 1 |
| Genbank accession: | NM_003165 |
| Immunogen: | STXBP1 (NP_003156, 74 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI |
| Protein accession: | NP_003156 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | MUNC18-1 gene abnormalities are involved in neurodevelopmental disorders through defective cortical architecture during brain development.Hamada N, Iwamoto I, Tabata H, Nagata KI. Acta Neuropathol Commun. 2017 Nov 30;5(1):92. |