Brand: | Abnova |
Reference: | H00006811-M01 |
Product name: | STX5A monoclonal antibody (M01), clone 5A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STX5A. |
Clone: | 5A6 |
Isotype: | IgG1 Kappa |
Gene id: | 6811 |
Gene name: | STX5 |
Gene alias: | SED5|STX5A |
Gene description: | syntaxin 5 |
Genbank accession: | NM_003164.1 |
Immunogen: | STX5A (NP_003155.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQ |
Protein accession: | NP_003155.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to STX5A on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |