STX1A monoclonal antibody (M01), clone 1F9-1C9 View larger

STX1A monoclonal antibody (M01), clone 1F9-1C9

H00006804-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STX1A monoclonal antibody (M01), clone 1F9-1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about STX1A monoclonal antibody (M01), clone 1F9-1C9

Brand: Abnova
Reference: H00006804-M01
Product name: STX1A monoclonal antibody (M01), clone 1F9-1C9
Product description: Mouse monoclonal antibody raised against a full length recombinant STX1A.
Clone: 1F9-1C9
Isotype: IgG1 kappa
Gene id: 6804
Gene name: STX1A
Gene alias: HPC-1|STX1|p35-1
Gene description: syntaxin 1A (brain)
Genbank accession: BC003011.1
Immunogen: STX1A (AAH03011.1, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Protein accession: AAH03011.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006804-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged STX1A is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STX1A monoclonal antibody (M01), clone 1F9-1C9 now

Add to cart