STK11 purified MaxPab rabbit polyclonal antibody (D01P) View larger

STK11 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STK11 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr,PLA-Ce

More info about STK11 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00006794-D01P
Product name: STK11 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human STK11 protein.
Gene id: 6794
Gene name: STK11
Gene alias: LKB1|PJS
Gene description: serine/threonine kinase 11
Genbank accession: NM_000455.4
Immunogen: STK11 (NP_000446.1, 1 a.a. ~ 433 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
Protein accession: NP_000446.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00006794-D01P-13-15-1.jpg
Application image note: Western Blot analysis of STK11 expression in transfected 293T cell line (H00006794-T01) by STK11 MaxPab polyclonal antibody.

Lane 1: STK11 transfected lysate(48.60 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy STK11 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart