Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AURKA monoclonal antibody (M01), clone 5F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about AURKA monoclonal antibody (M01), clone 5F8
| Brand: | Abnova |
| Reference: | H00006790-M01 |
| Product name: | AURKA monoclonal antibody (M01), clone 5F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK6. |
| Clone: | 5F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6790 |
| Gene name: | AURKA |
| Gene alias: | AIK|ARK1|AURA|AURORA2|BTAK|MGC34538|STK15|STK6|STK7 |
| Gene description: | aurora kinase A |
| Genbank accession: | NM_198433 |
| Immunogen: | AURKA (NP_940835, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNP |
| Protein accession: | NP_940835 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | STK6 monoclonal antibody (M01), clone 5F8 Western Blot analysis of STK6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | KIBRA Protein Phosphorylation Is Regulated by Mitotic Kinase Aurora and Protein Phosphatase 1.Xiao L, Chen Y, Ji M, Volle DJ, Lewis RE, Tsai MY, Dong J. J Biol Chem. 2011 Oct 21;286(42):36304-15. Epub 2011 Aug 30. |