Brand: | Abnova |
Reference: | H00006789-M02 |
Product name: | STK4 monoclonal antibody (M02), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK4. |
Clone: | 4F4 |
Isotype: | IgG2a Kappa |
Gene id: | 6789 |
Gene name: | STK4 |
Gene alias: | DKFZp686A2068|KRS2|MST1|YSK3 |
Gene description: | serine/threonine kinase 4 |
Genbank accession: | NM_006282 |
Immunogen: | STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ |
Protein accession: | NP_006273 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | STK4 monoclonal antibody (M02), clone 4F4 Western Blot analysis of STK4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |