Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006788-M13 |
Product name: | STK3 monoclonal antibody (M13), clone 4F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK3. |
Clone: | 4F7 |
Isotype: | IgG2b Kappa |
Gene id: | 6788 |
Gene name: | STK3 |
Gene alias: | FLJ90748|KRS1|MST2 |
Gene description: | serine/threonine kinase 3 (STE20 homolog, yeast) |
Genbank accession: | BC010640 |
Immunogen: | STK3 (AAH10640.1, 311 a.a. ~ 431 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKV |
Protein accession: | AAH10640.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STK3 expression in transfected 293T cell line by STK3 monoclonal antibody (M13), clone 4F7. Lane 1: STK3 transfected lysate(56.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |