ELOVL4 polyclonal antibody (A01) View larger

ELOVL4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELOVL4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ELOVL4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006785-A01
Product name: ELOVL4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ELOVL4.
Gene id: 6785
Gene name: ELOVL4
Gene alias: ADMD|FLJ17667|FLJ92876|STGD2|STGD3
Gene description: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4
Genbank accession: NM_022726
Immunogen: ELOVL4 (NP_073563, 99 a.a. ~ 154 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV
Protein accession: NP_073563
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ELOVL4 polyclonal antibody (A01) now

Add to cart