Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STC1 monoclonal antibody (M01), clone 4H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about STC1 monoclonal antibody (M01), clone 4H4
| Brand: | Abnova |
| Reference: | H00006781-M01 |
| Product name: | STC1 monoclonal antibody (M01), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STC1. |
| Clone: | 4H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6781 |
| Gene name: | STC1 |
| Gene alias: | STC |
| Gene description: | stanniocalcin 1 |
| Genbank accession: | BC029044 |
| Immunogen: | STC1 (AAH29044, 141 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Protein accession: | AAH29044 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged STC1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human stanniocalcin-1 interacts with nuclear and cytoplasmic proteins and acts as a SUMO E3 ligase.dos Santos MT, Trindade DM, Goncalves Kde A, Bressan GC, Anastassopoulos F, Yunes JA, Kobarg J. Mol Biosyst. 2011 Jan;7(1):180-93. Epub 2010 Nov 1. |