Brand: | Abnova |
Reference: | H00006778-M09 |
Product name: | STAT6 monoclonal antibody (M09), clone 4G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STAT6. |
Clone: | 4G7 |
Isotype: | IgG2a Kappa |
Gene id: | 6778 |
Gene name: | STAT6 |
Gene alias: | D12S1644|IL-4-STAT|STAT6B|STAT6C |
Gene description: | signal transducer and activator of transcription 6, interleukin-4 induced |
Genbank accession: | BC004973 |
Immunogen: | STAT6 (NP_003144, 694 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD |
Protein accession: | NP_003144 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | STAT6 monoclonal antibody (M09), clone 4G7. Western Blot analysis of STAT6 expression in Hela S3 NE(Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |