STAT6 monoclonal antibody (M01A), clone 6C10 View larger

STAT6 monoclonal antibody (M01A), clone 6C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAT6 monoclonal antibody (M01A), clone 6C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about STAT6 monoclonal antibody (M01A), clone 6C10

Brand: Abnova
Reference: H00006778-M01A
Product name: STAT6 monoclonal antibody (M01A), clone 6C10
Product description: Mouse monoclonal antibody raised against a partial recombinant STAT6.
Clone: 6C10
Isotype: IgG2b Kappa
Gene id: 6778
Gene name: STAT6
Gene alias: D12S1644|IL-4-STAT|STAT6B|STAT6C
Gene description: signal transducer and activator of transcription 6, interleukin-4 induced
Genbank accession: BC004973
Immunogen: STAT6 (NP_003144, 694 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
Protein accession: NP_003144
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006778-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006778-M01A-1-1-1.jpg
Application image note: STAT6 monoclonal antibody (M01A), clone 6C10 Western Blot analysis of STAT6 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy STAT6 monoclonal antibody (M01A), clone 6C10 now

Add to cart