STAT5A polyclonal antibody (A01) View larger

STAT5A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAT5A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about STAT5A polyclonal antibody (A01)

Brand: Abnova
Reference: H00006776-A01
Product name: STAT5A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant STAT5A.
Gene id: 6776
Gene name: STAT5A
Gene alias: MGF|STAT5
Gene description: signal transducer and activator of transcription 5A
Genbank accession: BC027036
Immunogen: STAT5A (AAH27036, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Protein accession: AAH27036
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy STAT5A polyclonal antibody (A01) now

Add to cart