Brand: | Abnova |
Reference: | H00006773-M01 |
Product name: | STAT2 monoclonal antibody (M01), clone 5G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STAT2. |
Clone: | 5G7 |
Isotype: | IgG1 Kappa |
Gene id: | 6773 |
Gene name: | STAT2 |
Gene alias: | ISGF-3|MGC59816|P113|STAT113 |
Gene description: | signal transducer and activator of transcription 2, 113kDa |
Genbank accession: | BC051284 |
Immunogen: | STAT2 (AAH51284, 742 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF |
Protein accession: | AAH51284 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to STAT2 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |