STAT1 monoclonal antibody (M01), clone 1A8 View larger

STAT1 monoclonal antibody (M01), clone 1A8

H00006772-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAT1 monoclonal antibody (M01), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about STAT1 monoclonal antibody (M01), clone 1A8

Brand: Abnova
Reference: H00006772-M01
Product name: STAT1 monoclonal antibody (M01), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant STAT1.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 6772
Gene name: STAT1
Gene alias: DKFZp686B04100|ISGF-3|STAT91
Gene description: signal transducer and activator of transcription 1, 91kDa
Genbank accession: BC002704
Immunogen: STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Protein accession: AAH02704
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006772-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006772-M01-1-1-1.jpg
Application image note: STAT1 monoclonal antibody (M01), clone 1A8 Western Blot analysis of STAT1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STAT1 monoclonal antibody (M01), clone 1A8 now

Add to cart