Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ST14 monoclonal antibody (M05), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ST14 monoclonal antibody (M05), clone 2F4
| Brand: | Abnova |
| Reference: | H00006768-M05 |
| Product name: | ST14 monoclonal antibody (M05), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ST14. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6768 |
| Gene name: | ST14 |
| Gene alias: | HAI|MT-SP1|MTSP-1|MTSP1|PRSS14|SNC19|TADG-15 |
| Gene description: | suppression of tumorigenicity 14 (colon carcinoma) |
| Genbank accession: | NM_021978 |
| Immunogen: | ST14 (NP_068813, 298 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD |
| Protein accession: | NP_068813 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ST14 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Novel surface targets and serum biomarkers from the ovarian cancer vasculature.Sasaroli D, Gimotty PA, Pathak HB, Hammond R, Kougioumtzidou E, Katsaros D, Buckanovich R, Devarajan K, Sandaltzopoulos R, Godwin AK, Scholler N, Coukos G. Cancer Biol Ther. 2011 Aug 1;12(3):169-80. Epub 2011 Aug 1. |