ST13 (Human) Recombinant Protein (P01) View larger

ST13 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ST13 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ST13 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006767-P01
Product name: ST13 (Human) Recombinant Protein (P01)
Product description: Human ST13 full-length ORF ( AAH15317, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6767
Gene name: ST13
Gene alias: AAG2|FAM10A1|FAM10A4|FLJ27260|HIP|HOP|HSPABP|HSPABP1|MGC129952|P48|PRO0786|SNC6
Gene description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Genbank accession: BC015317
Immunogen sequence/protein sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Protein accession: AAH15317
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006767-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ST13 (Human) Recombinant Protein (P01) now

Add to cart