Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ST13 monoclonal antibody (M02), clone 2B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ST13 monoclonal antibody (M02), clone 2B2
| Brand: | Abnova |
| Reference: | H00006767-M02 |
| Product name: | ST13 monoclonal antibody (M02), clone 2B2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ST13. |
| Clone: | 2B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6767 |
| Gene name: | ST13 |
| Gene alias: | AAG2|FAM10A1|FAM10A4|FLJ27260|HIP|HOP|HSPABP|HSPABP1|MGC129952|P48|PRO0786|SNC6 |
| Gene description: | suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) |
| Genbank accession: | BC015317 |
| Immunogen: | ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF |
| Protein accession: | AAH15317 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |