Brand: | Abnova |
Reference: | H00006767-M02 |
Product name: | ST13 monoclonal antibody (M02), clone 2B2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ST13. |
Clone: | 2B2 |
Isotype: | IgG2a Kappa |
Gene id: | 6767 |
Gene name: | ST13 |
Gene alias: | AAG2|FAM10A1|FAM10A4|FLJ27260|HIP|HOP|HSPABP|HSPABP1|MGC129952|P48|PRO0786|SNC6 |
Gene description: | suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) |
Genbank accession: | BC015317 |
Immunogen: | ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF |
Protein accession: | AAH15317 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00006767-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00006767-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00006767-M02-9-20-1.jpg](http://www.abnova.com/application_image/H00006767-M02-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |