Brand: | Abnova |
Reference: | H00006759-M02J |
Product name: | SSX4 monoclonal antibody (M02J), clone 3E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SSX4. |
Clone: | 3E10 |
Isotype: | IgG2a Kappa |
Gene id: | 6759 |
Gene name: | SSX4 |
Gene alias: | MGC119056|MGC12411 |
Gene description: | synovial sarcoma, X breakpoint 4 |
Genbank accession: | NM_005636 |
Immunogen: | SSX4 (NP_005627, 91 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE |
Protein accession: | NP_005627 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |