SSX4 purified MaxPab mouse polyclonal antibody (B01P) View larger

SSX4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SSX4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SSX4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006759-B01P
Product name: SSX4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SSX4 protein.
Gene id: 6759
Gene name: SSX4
Gene alias: MGC119056|MGC12411
Gene description: synovial sarcoma, X breakpoint 4
Genbank accession: NM_005636.3
Immunogen: SSX4 (NP_005627.1, 1 a.a. ~ 188 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Protein accession: NP_005627.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006759-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SSX4 expression in transfected 293T cell line (H00006759-T01) by SSX4 MaxPab polyclonal antibody.

Lane 1: SSX4 transfected lysate(20.68 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SSX4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart