Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SSX1 monoclonal antibody (M01), clone 5B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SSX1 monoclonal antibody (M01), clone 5B2
| Brand: | Abnova |
| Reference: | H00006756-M01 |
| Product name: | SSX1 monoclonal antibody (M01), clone 5B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SSX1. |
| Clone: | 5B2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6756 |
| Gene name: | SSX1 |
| Gene alias: | MGC150425|MGC5162|SSRC |
| Gene description: | synovial sarcoma, X breakpoint 1 |
| Genbank accession: | NM_005635.2 |
| Immunogen: | SSX1 (NP_005626.1, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE |
| Protein accession: | NP_005626.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SSX1 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |