Brand: | Abnova |
Reference: | H00006748-M01 |
Product name: | SSR4 monoclonal antibody (M01), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SSR4. |
Clone: | 2D3 |
Isotype: | IgG1 Kappa |
Gene id: | 6748 |
Gene name: | SSR4 |
Gene alias: | TRAPD |
Gene description: | signal sequence receptor, delta (translocon-associated protein delta) |
Genbank accession: | BC003371 |
Immunogen: | SSR4 (AAH03371, 24 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA |
Protein accession: | AAH03371 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |