Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SSR4 monoclonal antibody (M01), clone 2D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SSR4 monoclonal antibody (M01), clone 2D3
| Brand: | Abnova |
| Reference: | H00006748-M01 |
| Product name: | SSR4 monoclonal antibody (M01), clone 2D3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SSR4. |
| Clone: | 2D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6748 |
| Gene name: | SSR4 |
| Gene alias: | TRAPD |
| Gene description: | signal sequence receptor, delta (translocon-associated protein delta) |
| Genbank accession: | BC003371 |
| Immunogen: | SSR4 (AAH03371, 24 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA |
| Protein accession: | AAH03371 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |