SSR2 monoclonal antibody (M01), clone 4C1 View larger

SSR2 monoclonal antibody (M01), clone 4C1

H00006746-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SSR2 monoclonal antibody (M01), clone 4C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SSR2 monoclonal antibody (M01), clone 4C1

Brand: Abnova
Reference: H00006746-M01
Product name: SSR2 monoclonal antibody (M01), clone 4C1
Product description: Mouse monoclonal antibody raised against a partial recombinant SSR2.
Clone: 4C1
Isotype: IgG2a Kappa
Gene id: 6746
Gene name: SSR2
Gene alias: DKFZp686F19123|HSD25|TLAP|TRAP-BETA|TRAPB
Gene description: signal sequence receptor, beta (translocon-associated protein beta)
Genbank accession: NM_003145
Immunogen: SSR2 (NP_003136.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW
Protein accession: NP_003136.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006746-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006746-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SSR2 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SSR2 monoclonal antibody (M01), clone 4C1 now

Add to cart