SSBP1 monoclonal antibody (M10), clone 4C1 View larger

SSBP1 monoclonal antibody (M10), clone 4C1

H00006742-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SSBP1 monoclonal antibody (M10), clone 4C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SSBP1 monoclonal antibody (M10), clone 4C1

Brand: Abnova
Reference: H00006742-M10
Product name: SSBP1 monoclonal antibody (M10), clone 4C1
Product description: Mouse monoclonal antibody raised against a full length recombinant SSBP1.
Clone: 4C1
Isotype: IgG2a Kappa
Gene id: 6742
Gene name: SSBP1
Gene alias: SSBP
Gene description: single-stranded DNA binding protein 1
Genbank accession: BC000895
Immunogen: SSBP1 (AAH00895, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
Protein accession: AAH00895
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006742-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.02 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006742-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SSBP1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Involvement of p53 in cell death following cell cycle arrest and mitotic catastrophe induced by rotenone.Goncalves AP, Maximo V, Lima J, Singh KK, Soares P, Videira A.
Biochim Biophys Acta. 2011 Jan 9. [Epub ahead of print]

Reviews

Buy SSBP1 monoclonal antibody (M10), clone 4C1 now

Add to cart