TROVE2 monoclonal antibody (M03), clone 1F2 View larger

TROVE2 monoclonal antibody (M03), clone 1F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TROVE2 monoclonal antibody (M03), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TROVE2 monoclonal antibody (M03), clone 1F2

Brand: Abnova
Reference: H00006738-M03
Product name: TROVE2 monoclonal antibody (M03), clone 1F2
Product description: Mouse monoclonal antibody raised against a partial recombinant TROVE2.
Clone: 1F2
Isotype: IgG2a Kappa
Gene id: 6738
Gene name: TROVE2
Gene alias: RO60|SSA2
Gene description: TROVE domain family, member 2
Genbank accession: NM_004600
Immunogen: TROVE2 (NP_004591, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
Protein accession: NP_004591
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006738-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006738-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TROVE2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TROVE2 monoclonal antibody (M03), clone 1F2 now

Add to cart