Brand: | Abnova |
Reference: | H00006722-M05 |
Product name: | SRF monoclonal antibody (M05), clone 4D2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SRF. |
Clone: | 4D2 |
Isotype: | IgG2a Kappa |
Gene id: | 6722 |
Gene name: | SRF |
Gene alias: | MCM1 |
Gene description: | serum response factor (c-fos serum response element-binding transcription factor) |
Genbank accession: | NM_003131 |
Immunogen: | SRF (NP_003122, 244 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV |
Protein accession: | NP_003122 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SRF monoclonal antibody (M05), clone 4D2. Western Blot analysis of SRF expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |