Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SRF monoclonal antibody (M05), clone 4D2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about SRF monoclonal antibody (M05), clone 4D2
| Brand: | Abnova |
| Reference: | H00006722-M05 |
| Product name: | SRF monoclonal antibody (M05), clone 4D2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SRF. |
| Clone: | 4D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6722 |
| Gene name: | SRF |
| Gene alias: | MCM1 |
| Gene description: | serum response factor (c-fos serum response element-binding transcription factor) |
| Genbank accession: | NM_003131 |
| Immunogen: | SRF (NP_003122, 244 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV |
| Protein accession: | NP_003122 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SRF monoclonal antibody (M05), clone 4D2. Western Blot analysis of SRF expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |