SRF monoclonal antibody (M04), clone 2C9 View larger

SRF monoclonal antibody (M04), clone 2C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRF monoclonal antibody (M04), clone 2C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about SRF monoclonal antibody (M04), clone 2C9

Brand: Abnova
Reference: H00006722-M04
Product name: SRF monoclonal antibody (M04), clone 2C9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SRF.
Clone: 2C9
Isotype: IgG2a Kappa
Gene id: 6722
Gene name: SRF
Gene alias: MCM1
Gene description: serum response factor (c-fos serum response element-binding transcription factor)
Genbank accession: NM_003131
Immunogen: SRF (NP_003122, 244 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV
Protein accession: NP_003122
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006722-M04-1-25-1.jpg
Application image note: SRF monoclonal antibody (M04), clone 2C9. Western Blot analysis of SRF expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy SRF monoclonal antibody (M04), clone 2C9 now

Add to cart