SRF monoclonal antibody (M02), clone 1C8 View larger

SRF monoclonal antibody (M02), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRF monoclonal antibody (M02), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SRF monoclonal antibody (M02), clone 1C8

Brand: Abnova
Reference: H00006722-M02
Product name: SRF monoclonal antibody (M02), clone 1C8
Product description: Mouse monoclonal antibody raised against a partial recombinant SRF.
Clone: 1C8
Isotype: IgG2a Kappa
Gene id: 6722
Gene name: SRF
Gene alias: MCM1
Gene description: serum response factor (c-fos serum response element-binding transcription factor)
Genbank accession: BC048211
Immunogen: SRF (AAH48211, 406 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
Protein accession: AAH48211
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006722-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006722-M02-1-25-1.jpg
Application image note: SRF monoclonal antibody (M02), clone 1C8 Western Blot analysis of SRF expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SRF monoclonal antibody (M02), clone 1C8 now

Add to cart