Brand: | Abnova |
Reference: | H00006721-A01 |
Product name: | SREBF2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SREBF2. |
Gene id: | 6721 |
Gene name: | SREBF2 |
Gene alias: | SREBP2|bHLHd2 |
Gene description: | sterol regulatory element binding transcription factor 2 |
Genbank accession: | BC056158 |
Immunogen: | SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT |
Protein accession: | AAH56158 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SREBF2 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of SREBF2 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |