Brand: | Abnova |
Reference: | H00006720-M02 |
Product name: | SREBF1 monoclonal antibody (M02), clone 4C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SREBF1. |
Clone: | 4C11 |
Isotype: | IgG2a Kappa |
Gene id: | 6720 |
Gene name: | SREBF1 |
Gene alias: | SREBP-1c|SREBP1|bHLHd1 |
Gene description: | sterol regulatory element binding transcription factor 1 |
Genbank accession: | BC057388 |
Immunogen: | SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL |
Protein accession: | AAH57388 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SREBF1 monoclonal antibody (M02), clone 4C11 Western Blot analysis of SREBF1 expression in COLO 320 HSR ( Cat # L020V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |