SREBF1 monoclonal antibody (M01), clone 4B10 View larger

SREBF1 monoclonal antibody (M01), clone 4B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SREBF1 monoclonal antibody (M01), clone 4B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SREBF1 monoclonal antibody (M01), clone 4B10

Brand: Abnova
Reference: H00006720-M01
Product name: SREBF1 monoclonal antibody (M01), clone 4B10
Product description: Mouse monoclonal antibody raised against a partial recombinant SREBF1.
Clone: 4B10
Isotype: IgG2a Kappa
Gene id: 6720
Gene name: SREBF1
Gene alias: SREBP-1c|SREBP1|bHLHd1
Gene description: sterol regulatory element binding transcription factor 1
Genbank accession: BC057388
Immunogen: SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Protein accession: AAH57388
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006720-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006720-M01-1-12-1.jpg
Application image note: SREBF1 monoclonal antibody (M01), clone 4B10 Western Blot analysis of SREBF1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SREBF1 monoclonal antibody (M01), clone 4B10 now

Add to cart