AKR1D1 monoclonal antibody (M03), clone 1C2 View larger

AKR1D1 monoclonal antibody (M03), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1D1 monoclonal antibody (M03), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about AKR1D1 monoclonal antibody (M03), clone 1C2

Brand: Abnova
Reference: H00006718-M03
Product name: AKR1D1 monoclonal antibody (M03), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant AKR1D1.
Clone: 1C2
Isotype: IgG2b Kappa
Gene id: 6718
Gene name: AKR1D1
Gene alias: 3o5bred|SRD5B1
Gene description: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Genbank accession: NM_005989
Immunogen: AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Protein accession: NP_005980
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006718-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006718-M03-42-R01V-1.jpg
Application image note: Western blot analysis of AKR1D1 over-expressed 293 cell line, cotransfected with AKR1D1 Validated Chimera RNAi ( Cat # H00006718-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKR1D1 monoclonal antibody (M03), clone 1C2 (Cat # H00006718-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy AKR1D1 monoclonal antibody (M03), clone 1C2 now

Add to cart