Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00006718-M01 |
Product name: | AKR1D1 monoclonal antibody (M01), clone 1A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKR1D1. |
Clone: | 1A6 |
Isotype: | IgG2b Kappa |
Gene id: | 6718 |
Gene name: | AKR1D1 |
Gene alias: | 3o5bred|SRD5B1 |
Gene description: | aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) |
Genbank accession: | NM_005989 |
Immunogen: | AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY |
Protein accession: | NP_005980 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AKR1D1 expression in transfected 293T cell line by AKR1D1 monoclonal antibody (M01), clone 1A6. Lane 1: AKR1D1 transfected lysate(37.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr,IP |
Shipping condition: | Dry Ice |