AKR1D1 monoclonal antibody (M01), clone 1A6 View larger

AKR1D1 monoclonal antibody (M01), clone 1A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1D1 monoclonal antibody (M01), clone 1A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr,IP

More info about AKR1D1 monoclonal antibody (M01), clone 1A6

Brand: Abnova
Reference: H00006718-M01
Product name: AKR1D1 monoclonal antibody (M01), clone 1A6
Product description: Mouse monoclonal antibody raised against a partial recombinant AKR1D1.
Clone: 1A6
Isotype: IgG2b Kappa
Gene id: 6718
Gene name: AKR1D1
Gene alias: 3o5bred|SRD5B1
Gene description: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Genbank accession: NM_005989
Immunogen: AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Protein accession: NP_005980
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006718-M01-13-15-1.jpg
Application image note: Western Blot analysis of AKR1D1 expression in transfected 293T cell line by AKR1D1 monoclonal antibody (M01), clone 1A6.

Lane 1: AKR1D1 transfected lysate(37.4 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy AKR1D1 monoclonal antibody (M01), clone 1A6 now

Add to cart