AKR1D1 purified MaxPab mouse polyclonal antibody (B01P) View larger

AKR1D1 purified MaxPab mouse polyclonal antibody (B01P)

H00006718-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1D1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about AKR1D1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006718-B01P
Product name: AKR1D1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human AKR1D1 protein.
Gene id: 6718
Gene name: AKR1D1
Gene alias: 3o5bred|SRD5B1
Gene description: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Genbank accession: NM_005989.2
Immunogen: AKR1D1 (NP_005980.1, 1 a.a. ~ 326 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Protein accession: NP_005980.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006718-B01P-2-A1-1.jpg
Application image note: AKR1D1 MaxPab polyclonal antibody. Western Blot analysis of AKR1D1 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AKR1D1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart