Brand: | Abnova |
Reference: | H00006716-M01 |
Product name: | SRD5A2 monoclonal antibody (M01), clone 1F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SRD5A2. |
Clone: | 1F4 |
Isotype: | IgG1 Kappa |
Gene id: | 6716 |
Gene name: | SRD5A2 |
Gene alias: | MGC138457 |
Gene description: | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
Genbank accession: | NM_000348 |
Immunogen: | SRD5A2 (NP_000339.2, 28 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA |
Protein accession: | NP_000339.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SRD5A2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Resistance training restores muscle sex steroid hormone steroidogenesis in older men.Sato K, Iemitsu M, Matsutani K, Kurihara T, Hamaoka T, Fujita S FASEB J. 2014 Apr;28(4):1891-7. doi: 10.1096/fj.13-245480. Epub 2014 Jan 17. |