SRD5A2 monoclonal antibody (M01), clone 1F4 View larger

SRD5A2 monoclonal antibody (M01), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRD5A2 monoclonal antibody (M01), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SRD5A2 monoclonal antibody (M01), clone 1F4

Brand: Abnova
Reference: H00006716-M01
Product name: SRD5A2 monoclonal antibody (M01), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant SRD5A2.
Clone: 1F4
Isotype: IgG1 Kappa
Gene id: 6716
Gene name: SRD5A2
Gene alias: MGC138457
Gene description: steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Genbank accession: NM_000348
Immunogen: SRD5A2 (NP_000339.2, 28 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Protein accession: NP_000339.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006716-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (29.81 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006716-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SRD5A2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Resistance training restores muscle sex steroid hormone steroidogenesis in older men.Sato K, Iemitsu M, Matsutani K, Kurihara T, Hamaoka T, Fujita S
FASEB J. 2014 Apr;28(4):1891-7. doi: 10.1096/fj.13-245480. Epub 2014 Jan 17.

Reviews

Buy SRD5A2 monoclonal antibody (M01), clone 1F4 now

Add to cart