Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006715-D01P |
| Product name: | SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SRD5A1 protein. |
| Gene id: | 6715 |
| Gene name: | SRD5A1 |
| Gene alias: | - |
| Gene description: | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) |
| Genbank accession: | NM_001047.2 |
| Immunogen: | SRD5A1 (NP_001038.1, 1 a.a. ~ 259 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF |
| Protein accession: | NP_001038.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SRD5A1 expression in transfected 293T cell line (H00006715-T03) by SRD5A1 MaxPab polyclonal antibody. Lane 1: SRD5A1 transfected lysate(29.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | DHEA Administration Activates Local Bioactive Androgen Metabolism in Cancellous Site of Tibia of Ovariectomized Rats.Park JH, Aizawa K, Iemitsu M, Sato K, Akimoto T, Agata U, Maeda S, Ezawa I, Omi N. Calcif Tissue Int. 2011 Jun 8. [Epub ahead of print] |