SRC monoclonal antibody (M01), clone 1B9 View larger

SRC monoclonal antibody (M01), clone 1B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRC monoclonal antibody (M01), clone 1B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about SRC monoclonal antibody (M01), clone 1B9

Brand: Abnova
Reference: H00006714-M01
Product name: SRC monoclonal antibody (M01), clone 1B9
Product description: Mouse monoclonal antibody raised against a partial recombinant SRC.
Clone: 1B9
Isotype: IgG2a Kappa
Gene id: 6714
Gene name: SRC
Gene alias: ASV|SRC1|c-SRC|p60-Src
Gene description: v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Genbank accession: BC011566
Immunogen: SRC (AAH11566, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV
Protein accession: AAH11566
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006714-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.90 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged SRC is approximately 30ng/ml as a capture antibody.
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy SRC monoclonal antibody (M01), clone 1B9 now

Add to cart