SPTBN2 monoclonal antibody (M06), clone 4D9 View larger

SPTBN2 monoclonal antibody (M06), clone 4D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPTBN2 monoclonal antibody (M06), clone 4D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SPTBN2 monoclonal antibody (M06), clone 4D9

Brand: Abnova
Reference: H00006712-M06
Product name: SPTBN2 monoclonal antibody (M06), clone 4D9
Product description: Mouse monoclonal antibody raised against a partial recombinant SPTBN2.
Clone: 4D9
Isotype: IgG3 Kappa
Gene id: 6712
Gene name: SPTBN2
Gene alias: GTRAP41|SCA5
Gene description: spectrin, beta, non-erythrocytic 2
Genbank accession: NM_006946
Immunogen: SPTBN2 (NP_008877, 643 a.a. ~ 720 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
Protein accession: NP_008877
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006712-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006712-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SPTBN2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPTBN2 monoclonal antibody (M06), clone 4D9 now

Add to cart