Brand: | Abnova |
Reference: | H00006707-M01 |
Product name: | SPRR3 monoclonal antibody (M01), clone 4A12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SPRR3. |
Clone: | 4A12 |
Isotype: | IgG3 Kappa |
Gene id: | 6707 |
Gene name: | SPRR3 |
Gene alias: | - |
Gene description: | small proline-rich protein 3 |
Genbank accession: | BC017802 |
Immunogen: | SPRR3 (AAH17802, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK |
Protein accession: | AAH17802 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.45 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to SPRR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Identification and evaluation of potential forensic marker proteins in vaginal fluid by liquid chromatography/mass spectrometry.Igoh A, Doi Y, Sakurada K. Anal Bioanal Chem. 2015 Jul 12. [Epub ahead of print] |