SPRR3 monoclonal antibody (M01), clone 4A12 View larger

SPRR3 monoclonal antibody (M01), clone 4A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPRR3 monoclonal antibody (M01), clone 4A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SPRR3 monoclonal antibody (M01), clone 4A12

Brand: Abnova
Reference: H00006707-M01
Product name: SPRR3 monoclonal antibody (M01), clone 4A12
Product description: Mouse monoclonal antibody raised against a full length recombinant SPRR3.
Clone: 4A12
Isotype: IgG3 Kappa
Gene id: 6707
Gene name: SPRR3
Gene alias: -
Gene description: small proline-rich protein 3
Genbank accession: BC017802
Immunogen: SPRR3 (AAH17802, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK
Protein accession: AAH17802
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006707-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006707-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SPRR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Identification and evaluation of potential forensic marker proteins in vaginal fluid by liquid chromatography/mass spectrometry.Igoh A, Doi Y, Sakurada K.
Anal Bioanal Chem. 2015 Jul 12. [Epub ahead of print]

Reviews

Buy SPRR3 monoclonal antibody (M01), clone 4A12 now

Add to cart