SPRR2F monoclonal antibody (M03), clone 5A9 View larger

SPRR2F monoclonal antibody (M03), clone 5A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPRR2F monoclonal antibody (M03), clone 5A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SPRR2F monoclonal antibody (M03), clone 5A9

Brand: Abnova
Reference: H00006705-M03
Product name: SPRR2F monoclonal antibody (M03), clone 5A9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SPRR2F.
Clone: 5A9
Isotype: IgG1 Kappa
Gene id: 6705
Gene name: SPRR2F
Gene alias: -
Gene description: small proline-rich protein 2F
Genbank accession: NM_001014450.1
Immunogen: SPRR2F (NP_001014450.1, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
Protein accession: NP_001014450.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006705-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006705-M03-13-15-1.jpg
Application image note: Western Blot analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9.

Lane 1: SPRR2F transfected lysate(7.8 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPRR2F monoclonal antibody (M03), clone 5A9 now

Add to cart