SPR monoclonal antibody (M01), clone 4F2 View larger

SPR monoclonal antibody (M01), clone 4F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPR monoclonal antibody (M01), clone 4F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about SPR monoclonal antibody (M01), clone 4F2

Brand: Abnova
Reference: H00006697-M01
Product name: SPR monoclonal antibody (M01), clone 4F2
Product description: Mouse monoclonal antibody raised against a partial recombinant SPR.
Clone: 4F2
Isotype: IgG2a Kappa
Gene id: 6697
Gene name: SPR
Gene alias: SDR38C1
Gene description: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Genbank accession: NM_003124
Immunogen: SPR (NP_003115, 164 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Protein accession: NP_003115
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006697-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006697-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SPR is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SPR monoclonal antibody (M01), clone 4F2 now

Add to cart