Brand: | Abnova |
Reference: | H00006697-M01 |
Product name: | SPR monoclonal antibody (M01), clone 4F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPR. |
Clone: | 4F2 |
Isotype: | IgG2a Kappa |
Gene id: | 6697 |
Gene name: | SPR |
Gene alias: | SDR38C1 |
Gene description: | sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) |
Genbank accession: | NM_003124 |
Immunogen: | SPR (NP_003115, 164 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD |
Protein accession: | NP_003115 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SPR is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |