SPP1 monoclonal antibody (M21), clone X1 View larger

SPP1 monoclonal antibody (M21), clone X1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPP1 monoclonal antibody (M21), clone X1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about SPP1 monoclonal antibody (M21), clone X1

Brand: Abnova
Reference: H00006696-M21
Product name: SPP1 monoclonal antibody (M21), clone X1
Product description: Mouse monoclonal antibody raised against a partial recombinant SPP1.
Clone: X1
Isotype: IgG2b Kappa
Gene id: 6696
Gene name: SPP1
Gene alias: BNSP|BSPI|ETA-1|MGC110940|OPN
Gene description: secreted phosphoprotein 1
Genbank accession: NM_000582
Immunogen: SPP1 (NP_000573, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSR
Protein accession: NP_000573
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006696-M21-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006696-M21-3-46-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SPP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPP1 monoclonal antibody (M21), clone X1 now

Add to cart