SPP1 monoclonal antibody (M15), clone 3C7 View larger

SPP1 monoclonal antibody (M15), clone 3C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPP1 monoclonal antibody (M15), clone 3C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about SPP1 monoclonal antibody (M15), clone 3C7

Brand: Abnova
Reference: H00006696-M15
Product name: SPP1 monoclonal antibody (M15), clone 3C7
Product description: Mouse monoclonal antibody raised against a partial recombinant SPP1.
Clone: 3C7
Isotype: IgG2b Kappa
Gene id: 6696
Gene name: SPP1
Gene alias: BNSP|BSPI|ETA-1|MGC110940|OPN
Gene description: secreted phosphoprotein 1
Genbank accession: NM_000582
Immunogen: SPP1 (NP_000573.1, 21 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
Protein accession: NP_000573.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006696-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006696-M15-13-15-1.jpg
Application image note: Western Blot analysis of SPP1 expression in transfected 293T cell line by SPP1 monoclonal antibody (M15), clone 3C7.

Lane 1: SPP1 transfected lysate(35.4 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPP1 monoclonal antibody (M15), clone 3C7 now

Add to cart