Brand: | Abnova |
Reference: | H00006696-M13 |
Product name: | SPP1 monoclonal antibody (M13), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SPP1. |
Clone: | 4B8 |
Isotype: | IgG2a Kappa |
Gene id: | 6696 |
Gene name: | SPP1 |
Gene alias: | BNSP|BSPI|ETA-1|MGC110940|OPN |
Gene description: | secreted phosphoprotein 1 |
Genbank accession: | NM_000582 |
Immunogen: | SPP1 (NP_000573.1, 21 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT |
Protein accession: | NP_000573.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SPP1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |