SPN monoclonal antibody (M01), clone 3G8 View larger

SPN monoclonal antibody (M01), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPN monoclonal antibody (M01), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SPN monoclonal antibody (M01), clone 3G8

Brand: Abnova
Reference: H00006693-M01
Product name: SPN monoclonal antibody (M01), clone 3G8
Product description: Mouse monoclonal antibody raised against a full length recombinant SPN.
Clone: 3G8
Isotype: IgG2a Kappa
Gene id: 6693
Gene name: SPN
Gene alias: CD43|GPL115|LSN
Gene description: sialophorin
Genbank accession: BC012350
Immunogen: SPN (AAH12350, 1 a.a. ~ 400 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Protein accession: AAH12350
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006693-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (69.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006693-M01-13-15-1.jpg
Application image note: Western Blot analysis of SPN expression in transfected 293T cell line by SPN monoclonal antibody (M01), clone 3G8.

Lane 1: SPN transfected lysate(59.327 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPN monoclonal antibody (M01), clone 3G8 now

Add to cart