SPINK1 monoclonal antibody (M01A), clone 4D4 View larger

SPINK1 monoclonal antibody (M01A), clone 4D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPINK1 monoclonal antibody (M01A), clone 4D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about SPINK1 monoclonal antibody (M01A), clone 4D4

Brand: Abnova
Reference: H00006690-M01A
Product name: SPINK1 monoclonal antibody (M01A), clone 4D4
Product description: Mouse monoclonal antibody raised against a partial recombinant SPINK1.
Clone: 4D4
Isotype: IgG2a Kappa
Gene id: 6690
Gene name: SPINK1
Gene alias: PCTT|PSTI|Spink3|TATI
Gene description: serine peptidase inhibitor, Kazal type 1
Genbank accession: BC025790
Immunogen: SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Protein accession: AAH25790
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006690-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006690-M01A-2-A7-1.jpg
Application image note: SPINK1 monoclonal antibody (M01A), clone 4D4. Western Blot analysis of SPINK1 expression in human pancreas.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPINK1 monoclonal antibody (M01A), clone 4D4 now

Add to cart