SPINK1 monoclonal antibody (M01), clone 4D4 View larger

SPINK1 monoclonal antibody (M01), clone 4D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPINK1 monoclonal antibody (M01), clone 4D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,IP

More info about SPINK1 monoclonal antibody (M01), clone 4D4

Brand: Abnova
Reference: H00006690-M01
Product name: SPINK1 monoclonal antibody (M01), clone 4D4
Product description: Mouse monoclonal antibody raised against a partial recombinant SPINK1.
Clone: 4D4
Isotype: IgG2a Kappa
Gene id: 6690
Gene name: SPINK1
Gene alias: PCTT|PSTI|Spink3|TATI
Gene description: serine peptidase inhibitor, Kazal type 1
Genbank accession: BC025790
Immunogen: SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Protein accession: AAH25790
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006690-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006690-M01-3-38-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml]
Applications: WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice
Publications: Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India.Ateeq B, Kunju LP, Carskadon SL, Pandey SK, Singh G, Pradeep I, Tandon V, Singhai A, Goel A, Amit S, Agarwal A, Dinda AK, Seth A, Tsodikov A, Chinnaiyan AM, Palanisamy N
Prostate. 2015 Mar 23. doi: 10.1002/pros.22989.

Reviews

Buy SPINK1 monoclonal antibody (M01), clone 4D4 now

Add to cart