SPAST monoclonal antibody (M01), clone 3A12 View larger

SPAST monoclonal antibody (M01), clone 3A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPAST monoclonal antibody (M01), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SPAST monoclonal antibody (M01), clone 3A12

Brand: Abnova
Reference: H00006683-M01
Product name: SPAST monoclonal antibody (M01), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant SPAST.
Clone: 3A12
Isotype: IgG2b Kappa
Gene id: 6683
Gene name: SPAST
Gene alias: ADPSP|FSP2|KIAA1083|SPG4
Gene description: spastin
Genbank accession: NM_014946
Immunogen: SPAST (NP_055761, 200 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP
Protein accession: NP_055761
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006683-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006683-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SPAST is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPAST monoclonal antibody (M01), clone 3A12 now

Add to cart