Brand: | Abnova |
Reference: | H00006683-M01 |
Product name: | SPAST monoclonal antibody (M01), clone 3A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPAST. |
Clone: | 3A12 |
Isotype: | IgG2b Kappa |
Gene id: | 6683 |
Gene name: | SPAST |
Gene alias: | ADPSP|FSP2|KIAA1083|SPG4 |
Gene description: | spastin |
Genbank accession: | NM_014946 |
Immunogen: | SPAST (NP_055761, 200 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP |
Protein accession: | NP_055761 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SPAST is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |