SPARC monoclonal antibody (M04A), clone 1A2 View larger

SPARC monoclonal antibody (M04A), clone 1A2

H00006678-M04A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPARC monoclonal antibody (M04A), clone 1A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr

More info about SPARC monoclonal antibody (M04A), clone 1A2

Brand: Abnova
Reference: H00006678-M04A
Product name: SPARC monoclonal antibody (M04A), clone 1A2
Product description: Mouse monoclonal antibody raised against a full-length recombinant SPARC.
Clone: 1A2
Isotype: IgG1 Kappa
Gene id: 6678
Gene name: SPARC
Gene alias: ON
Gene description: secreted protein, acidic, cysteine-rich (osteonectin)
Genbank accession: BC004974
Immunogen: SPARC (AAH04974.1, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Protein accession: AAH04974.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006678-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006678-M04A-1-12-1.jpg
Application image note: SPARC monoclonal antibody (M04A), clone 1A2. Western Blot analysis of SPARC expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPARC monoclonal antibody (M04A), clone 1A2 now

Add to cart