Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPARC monoclonal antibody (M02), clone 1B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SPARC monoclonal antibody (M02), clone 1B2
| Brand: | Abnova |
| Reference: | H00006678-M02 |
| Product name: | SPARC monoclonal antibody (M02), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SPARC. |
| Clone: | 1B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6678 |
| Gene name: | SPARC |
| Gene alias: | ON |
| Gene description: | secreted protein, acidic, cysteine-rich (osteonectin) |
| Genbank accession: | BC004974 |
| Immunogen: | SPARC (AAH04974.1, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
| Protein accession: | AAH04974.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (59.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SPARC monoclonal antibody (M02), clone 1B2 Western Blot analysis of SPARC expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The matricellular protein SPARC supports follicular dendritic cell networking toward Th17 responses.Piconese S, Costanza M, Tripodo C, Sangaletti S, Musio S, Pittoni P, Poliani PL, Burocchi A, Passafaro AL, Gorzanelli A, Vitali C, Chiodoni C, Barnaba V, Pedotti R, Colombo MP. J Autoimmun. 2011 Sep 28. |